PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_02567_BGI-A2_v1.0
Common NameF383_09215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 315aa    MW: 33825.3 Da    PI: 8.6261
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_02567_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.42.1e-32173229158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 +ep+YVNaKQyq+Il+RRq+Rak+e ekk+  ksrkpylheSRh+hAlrR+RgsgGrF
  Cotton_A_02567_BGI-A2_v1.0 173 QEPVYVNAKQYQGILRRRQARAKAELEKKV-VKSRKPYLHESRHQHALRRARGSGGRF 229
                                 69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-35171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.949172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-28174229IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-24175197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860177197IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-24206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQSNSEEGSR LEPAVHGVHP TAVYSEPKWR NTGYGAISPG VRGVNSLNSS SMECTNASES  60
NDGQSLSNGA LNEEDDVNKE TQTTASSRAV GTGGQEHHNL QHVGSSMPAV RDEGLTQPPL  120
LELVGHSIAC ASNPYIDPLY GGMMAAYGHQ PMGYPPFVGM PHARMTLPIE MAQEPVYVNA  180
KQYQGILRRR QARAKAELEK KVVKSRKPYL HESRHQHALR RARGSGGRFA KKTDTNPGEE  240
KGSGSGPTLS SQSPSSSGSE PLQTDSNETW TSSLTQHGIH HVNGGSHYQK LGGNISNQAA  300
FYPVNGGQSF QKLKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19173229258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150384e-36AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012463850.10.0PREDICTED: nuclear transcription factor Y subunit A-1 isoform X1
SwissprotQ9LXV51e-87NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A0B0P1W80.0A0A0B0P1W8_G
STRINGGLYMA18G07890.21e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.32e-82nuclear factor Y, subunit A1